PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc10_g02400
Common NameGSCOC_T00024742001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family TALE
Protein Properties Length: 682aa    MW: 75516.2 Da    PI: 5.5757
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc10_g02400genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.2e-094334701954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Cc10_g02400 433 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 470
                  554459******************************88 PP

2BELL114.46e-37296367172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  er++lq+k +kL s+l+eVd+rYkqy++q+q+++ssFe+vag+g+a++Yt+lA ++iSr+FrcL+d i++qi
  Cc10_g02400 296 ERNDLQNKLTKLFSMLDEVDRRYKQYYQQMQVLVSSFEIVAGCGAARSYTALARRTISRQFRCLRDSIKNQI 367
                  7899******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-50222365IPR006563POX domain
PfamPF075263.7E-44228363IPR006563POX domain
PROSITE profilePS5007112.341411474IPR001356Homeobox domain
SMARTSM003892.8E-10414478IPR001356Homeobox domain
CDDcd000869.49E-13414475No hitNo description
SuperFamilySSF466892.05E-17415481IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-28417480IPR009057Homeodomain-like
PfamPF059202.3E-17431470IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MSAYYPNLTS QQDVLQTQYL LNPKLTSYQS SDLPEIIYPN PPSTASLRPE LFSGTSLQAH  60
NFVEAQSVES REEMLFIAPH GNPVMMQPIN EHLNFAPNFS DSNAVVVDQI FTKKLLHLQN  120
ADQNLQNQGL SLSLGSQAAS SVEMPSYQNP YSNSGLSSLL SSHVEHLADR FSESSELKTA  180
EYLSFDLAGR VNNSSKVGAV YEPQSSLSSK GINSDPKLHE ETVVSGAIYN SKYLKAAKEL  240
LDEVVNVHQA LNQSEKCNEF QSSGLGVTEA TKLKAEYQSG IPSKTGISSD VLSPAERNDL  300
QNKLTKLFSM LDEVDRRYKQ YYQQMQVLVS SFEIVAGCGA ARSYTALARR TISRQFRCLR  360
DSIKNQIQVV QQCLGEEGTV PNGQGGGLSR LRHLDQQLRQ QRALQQFGVM RQPWRPQRGL  420
PETAVSVLRA WLFEHFLHPY PKDSEKIMLA RQTGLTRSQV ANWFINARVR LWKPMIEEMY  480
KEEFVDMEAD SKSSQEHGQP TGRLKSESED TGEELHESLM SPSADGGRLA QSSELRNDVT  540
SDLKVHAYAT RMGFQAGSLE ENDMDHLNKS SRDDVVSMAD HKVGAIETIR SNQTGDVSIS  600
SDANAHNFCM LAGPVGNQVS LALGLQHPSK DSQPISDGTH TGVDDTAASS VGLDKAEYYC  660
LDAINQQERF SHPHLLSDFV L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-17420477158Homeobox protein Meis1
4xrs_B6e-17420477158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568507.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLA0A068UFX50.0A0A068UFX5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.12e-99BEL1-like homeodomain 7